PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca13008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 509aa    MW: 57372.3 Da    PI: 4.5799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca13008.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.9e-51101371127
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lp GfrF+Ptd el+++yL+ k++gk++++ ++i+e+di++vePwdLp+  ++k++++ew+fF++rd+kya++ r+nrat++gyWkatgkd++++s++ 
  Dca13008.1  10 LPLGFRFKPTDVELIDHYLRLKINGKHNQV-SCIQEIDICSVEPWDLPAlsAIKTQDHEWFFFCPRDRKYASSLRSNRATEKGYWKATGKDRTIKSRRM 107
                 699************************999.89***************4458899999***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyr 127
                  l+g+kktLvfy+grapkg++t+Wv+heyr
  Dca13008.1 108 GLIGTKKTLVFYEGRAPKGKRTSWVIHEYR 137
                 *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-557161IPR003441NAC domain
PROSITE profilePS5100553.85910161IPR003441NAC domain
PfamPF023652.4E-2511137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MGTLGKFEEL PLGFRFKPTD VELIDHYLRL KINGKHNQVS CIQEIDICSV EPWDLPALSA  60
IKTQDHEWFF FCPRDRKYAS SLRSNRATEK GYWKATGKDR TIKSRRMGLI GTKKTLVFYE  120
GRAPKGKRTS WVIHEYRPTL QELDGTNPGQ EAYILCRLFK KDDDLKQDEI DDIPNIYVLE  180
NDASAQNQTS TLVFQDDLRS EAAGVQASPV SVEQPVMQPE AAAGDIDFDS SFNIEEYINF  240
SCQSPRSSEV DTMRNADLLA CKKESVIENE SWPKMQPYSG VTGFSEQPIP NATQPKDETM  300
LSDDINQVLM NLSQIEDPLS VAENISLASP YGDYDFPQTF LSVSDYQVRG VQPMNFLQQQ  360
ETASRRSYLS ANFNESDGLD TIPSDDDIFS IDELISTPPD AEDEKLVVNG EGDFDTGIVL  420
KNRPSKMPDS RGKFNMQGTA PQRIRLRRFS FKSFNAEKHD RSSSEEVSLQ SGVDLPNRKC  480
SIVLVFILAF LFMACIGLWT TQKAGSPVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-381016715174Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.15e-80NAC transcription factor-like 9